PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0046200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 702aa    MW: 77423.6 Da    PI: 8.0914
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0046200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.18.5e-29457507252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek+isle+l+++Fs+++kdAAk+ gvc+T+LKriCRq+GI+RWP+Rkik++
  Spipo11G0046200 457 EKTISLEVLQQHFSGSLKDAAKSFGVCPTTLKRICRQHGISRWPSRKIKKV 507
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.211446527IPR003035RWP-RK domain
PfamPF020421.0E-26459507IPR003035RWP-RK domain
SuperFamilySSF542777.85E-20599687No hitNo description
SMARTSM006662.4E-22602685IPR000270PB1 domain
PROSITE profilePS5174518.616602685IPR000270PB1 domain
CDDcd064074.39E-38603684No hitNo description
Gene3DG3DSA:3.10.20.2401.6E-19603682No hitNo description
PfamPF005646.7E-15603684IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
NPAMRGLPHD SVQASVPGEA ETSSSLRTEP SADPDPISSL KERVVRAIGW IKEAHRDGDV  60
LVQIWVPTKK ENQQVLTTYG QPFSLNPNCQ RLMDYRTIST SYQFSAEENS DEVLGLPGRV  120
FVGKLPEWSP DVRYFSSQEY ARVSYAQHFD VRGTLALPIF ERSNRPCIGV LEVVMTTEKI  180
NYRSDLENIC NALQAVDLRS SEVPAVPRIK MKIESYVAAM PEIYAVLRAV CQTHGLPLAQ  240
TWVPCIQQGK SGSRHSDQNY RGCVSTVDGA CFVNDSSLFA FHEACSEHHL LRGQGVVGKA  300
FTTNQPCFSS DISAYSKTEY PLSHHARMFR LRAAVAIRLR SVNSGKCDFV LEFFLPMECL  360
ESEEQKVILN SLSMTMRQVC QSLRVITEKE LEDETTLQAN EQLVSSDAEL LAESSKALPD  420
PNQALGGDII EHGDSFTAKS DLSIKGKAAE KKRTKMEKTI SLEVLQQHFS GSLKDAAKSF  480
GVCPTTLKRI CRQHGISRWP SRKIKKVGHS LKKLQVVIDS IQGVDSALHL SSLYSDFSKA  540
DAPEPGRNPE KQDEPPASLS NSPSSSCGHS SSSSQSFSHR TRSFQSLGET KPAQCSRASA  600
GPLRVKASHG KEKIRLRLQP AWRLKDLKQE IARRFGIVRS SSMELKYLDD DSEWVLMTCD  660
ADLQECGDIH RSSGIPTVKI SVQHPARPRA AAAAASPTSG S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401874.10.0PREDICTED: protein NLP1-like isoform X2
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLM0SEP20.0M0SEP2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P14760_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein